| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
| Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins) automatically mapped to Pfam PF00576 |
| Protein automated matches [190376] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187223] (14 PDB entries) |
| Domain d4pmea_: 4pme A: [260221] automated match to d2roya_ complexed with cur, edo, fer, na |
PDB Entry: 4pme (more details), 1.26 Å
SCOPe Domain Sequences for d4pmea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pmea_ b.3.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
Timeline for d4pmea_: