Lineage for d4pmvb_ (4pmv B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2419594Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)
  8. 2419617Domain d4pmvb_: 4pmv B: [260220]
    automated match to d4k68a_

Details for d4pmvb_

PDB Entry: 4pmv (more details), 3 Å

PDB Description: crystal structure of a novel reducing-end xylose-releasing exo- oligoxylanase (xyna) belonging to gh10 family (space group p43212)
PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d4pmvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pmvb_ c.1.8.0 (B:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf
saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr
ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna
wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite
ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw
rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsat

SCOPe Domain Coordinates for d4pmvb_:

Click to download the PDB-style file with coordinates for d4pmvb_.
(The format of our PDB-style files is described here.)

Timeline for d4pmvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4pmva_