Lineage for d1ab9.1 (1ab9 A:,B:,C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2064432Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 2064433Species Cow (Bos taurus) [TaxId:9913] [50523] (60 PDB entries)
    Uniprot P00766
  8. 2064436Domain d1ab9.1: 1ab9 A:,B:,C: [26022]
    complexed with so4

Details for d1ab9.1

PDB Entry: 1ab9 (more details), 1.6 Å

PDB Description: crystal structure of bovine gamma-chymotrypsin
PDB Compounds: (A:) gamma-chymotrypsin, (B:) gamma-chymotrypsin, (C:) gamma-chymotrypsin

SCOPe Domain Sequences for d1ab9.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ab9.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryXntpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOPe Domain Coordinates for d1ab9.1:

Click to download the PDB-style file with coordinates for d1ab9.1.
(The format of our PDB-style files is described here.)

Timeline for d1ab9.1: