Lineage for d4p1bh_ (4p1b H:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1782958Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1783029Protein Toluene-4-monooxygenase system protein C, TmoC [110154] (1 species)
  7. 1783030Species Pseudomonas mendocina [TaxId:300] [110155] (5 PDB entries)
    Uniprot Q00458
  8. 1783033Domain d4p1bh_: 4p1b H: [260216]
    Other proteins in same PDB: d4p1ba_, d4p1bc_, d4p1bd_, d4p1bf_
    automated match to d1sjga_
    complexed with act, fe, fes, na, peg

Details for d4p1bh_

PDB Entry: 4p1b (more details), 2.05 Å

PDB Description: crystal structure of the toluene 4-monooxygenase hydroxylase- ferredoxin c7s e16c c84a c85a variant electron-transfer complex
PDB Compounds: (H:) Toluene-4-monooxygenase system ferredoxin subunit

SCOPe Domain Sequences for d4p1bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p1bh_ b.33.1.1 (H:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]}
sfekisslddiwvgcmetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnkahs

SCOPe Domain Coordinates for d4p1bh_:

Click to download the PDB-style file with coordinates for d4p1bh_.
(The format of our PDB-style files is described here.)

Timeline for d4p1bh_: