Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d4onoa3: 4ono A:300-393 [260211] Other proteins in same PDB: d4onoa2, d4onoa4, d4onoa5 automated match to d3ov6a3 complexed with cl, mli, pmk |
PDB Entry: 4ono (more details), 2.71 Å
SCOPe Domain Sequences for d4onoa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4onoa3 b.1.1.0 (A:300-393) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnaqgtw ylratldvadgeaaglscrvkhsslegqdiilyw
Timeline for d4onoa3:
View in 3D Domains from same chain: (mouse over for more information) d4onoa1, d4onoa2, d4onoa4, d4onoa5 |