Lineage for d4onoa3 (4ono A:300-393)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757765Domain d4onoa3: 4ono A:300-393 [260211]
    Other proteins in same PDB: d4onoa2, d4onoa4, d4onoa5
    automated match to d3ov6a3
    complexed with cl, mli, pmk

Details for d4onoa3

PDB Entry: 4ono (more details), 2.71 Å

PDB Description: cd1c in complex with pm (phosphomycoketide)
PDB Compounds: (A:) Beta-2-microglobulin/T-cell surface glycoprotein CD1c/T-cell surface glycoprotein CD1b chimeric protein

SCOPe Domain Sequences for d4onoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4onoa3 b.1.1.0 (A:300-393) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnaqgtw
ylratldvadgeaaglscrvkhsslegqdiilyw

SCOPe Domain Coordinates for d4onoa3:

Click to download the PDB-style file with coordinates for d4onoa3.
(The format of our PDB-style files is described here.)

Timeline for d4onoa3: