Lineage for d4onoa2 (4ono A:123-299)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938847Domain d4onoa2: 4ono A:123-299 [260210]
    Other proteins in same PDB: d4onoa1, d4onoa3, d4onoa4, d4onoa5
    automated match to d3ov6a2
    complexed with cl, mli, pmk

Details for d4onoa2

PDB Entry: 4ono (more details), 2.71 Å

PDB Description: cd1c in complex with pm (phosphomycoketide)
PDB Compounds: (A:) Beta-2-microglobulin/T-cell surface glycoprotein CD1c/T-cell surface glycoprotein CD1b chimeric protein

SCOPe Domain Sequences for d4onoa2:

Sequence, based on SEQRES records: (download)

>d4onoa2 d.19.1.0 (A:123-299) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhqwskgqfsneelsdle
llfrfylfgltreiqdhasqdyskypfevqvkagcelhsggspegffqvafngldllsfq
qttwvpspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvhr

Sequence, based on observed residues (ATOM records): (download)

>d4onoa2 d.19.1.0 (A:123-299) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhqwskgqfsneelsdle
llfrfylfgltreiqdhasypfevqvkagcelhsggspegffqvafngldllsfqqttwv
pspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvhr

SCOPe Domain Coordinates for d4onoa2:

Click to download the PDB-style file with coordinates for d4onoa2.
(The format of our PDB-style files is described here.)

Timeline for d4onoa2: