![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
![]() | Domain d4onoa2: 4ono A:123-299 [260210] Other proteins in same PDB: d4onoa1, d4onoa3, d4onoa4, d4onoa5 automated match to d3ov6a2 complexed with cl, mli, pmk |
PDB Entry: 4ono (more details), 2.71 Å
SCOPe Domain Sequences for d4onoa2:
Sequence, based on SEQRES records: (download)
>d4onoa2 d.19.1.0 (A:123-299) automated matches {Human (Homo sapiens) [TaxId: 9606]} vsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhqwskgqfsneelsdle llfrfylfgltreiqdhasqdyskypfevqvkagcelhsggspegffqvafngldllsfq qttwvpspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvhr
>d4onoa2 d.19.1.0 (A:123-299) automated matches {Human (Homo sapiens) [TaxId: 9606]} vsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhqwskgqfsneelsdle llfrfylfgltreiqdhasypfevqvkagcelhsggspegffqvafngldllsfqqttwv pspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvhr
Timeline for d4onoa2:
![]() Domains from same chain: (mouse over for more information) d4onoa1, d4onoa3, d4onoa4, d4onoa5 |