SCOPe 2.08: Domain d4onhb2: 4onh B:116-244

Lineage for d4onhb2 (4onh B:116-244)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4onhb2: 4onh B:116-244 [260208]
   Other proteins in same PDB: d4onha2
   automated match to d2axhb2
   complexed with cl, gol, nag

Details for d4onhb2

PDB Entry: 4onh, 3.01 Å

PDB Description: crystal structure of dn6 tcr

PDB Compounds: (B:) T-cell receptor alpha

SCOPe Domain Sequences for d4onhb2:

Sequence, based on SEQRES records:

>d4onhb2 b.1.1.0 (B:116-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Sequence, based on observed residues (ATOM records):

>d4onhb2 b.1.1.0 (B:116-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeisatlvclatgfypdhvelswwvngkevhsgvctdpqplke
qsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad

Timeline for d4onhb2:

• d4onhb2 first appeared in SCOPe 2.04
  
• d4onhb2 appears in SCOPe 2.07