Lineage for d4odxx_ (4odx X:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971248Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
    beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing
  4. 2971249Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) (S)
  5. 2971250Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins)
    automatically mapped to Pfam PF00359
  6. 2971267Protein automated matches [191189] (2 species)
    not a true protein
  7. 2971268Species Artificial gene [TaxId:32630] [189471] (2 PDB entries)
  8. 2971271Domain d4odxx_: 4odx X: [260201]
    Other proteins in same PDB: d4odxa_, d4odxb_, d4odxh_, d4odxl_
    automated match to d3lf6b_

Details for d4odxx_

PDB Entry: 4odx (more details), 3.1 Å

PDB Description: 4E10 germline encoded precursor no.7 in complex with epitope scaffold T117
PDB Compounds: (X:) 4E10 epitope scaffold T117

SCOPe Domain Sequences for d4odxx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4odxx_ d.112.1.1 (X:) automated matches {Artificial gene [TaxId: 32630]}
mqgihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpvep
vgvaiphtdskyvrqnaisvgilaepvnfedaggepdpvpvrvvfmlalgnwfditnvlw
wimdviqdedfmqqllvmnddeiyqsiytris

SCOPe Domain Coordinates for d4odxx_:

Click to download the PDB-style file with coordinates for d4odxx_.
(The format of our PDB-style files is described here.)

Timeline for d4odxx_: