Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily) beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing |
Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) |
Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins) automatically mapped to Pfam PF00359 |
Protein automated matches [191189] (2 species) not a true protein |
Species Artificial gene [TaxId:32630] [189471] (2 PDB entries) |
Domain d4odxx_: 4odx X: [260201] Other proteins in same PDB: d4odxa_, d4odxb_, d4odxh_, d4odxl_ automated match to d3lf6b_ |
PDB Entry: 4odx (more details), 3.1 Å
SCOPe Domain Sequences for d4odxx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4odxx_ d.112.1.1 (X:) automated matches {Artificial gene [TaxId: 32630]} mqgihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpvep vgvaiphtdskyvrqnaisvgilaepvnfedaggepdpvpvrvvfmlalgnwfditnvlw wimdviqdedfmqqllvmnddeiyqsiytris
Timeline for d4odxx_: