Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
Domain d4odxh_: 4odx H: [260200] Other proteins in same PDB: d4odxx_, d4odxy_ automated match to d2p49b_ |
PDB Entry: 4odx (more details), 3.1 Å
SCOPe Domain Sequences for d4odxh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4odxh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany aqkfqgrvtitadkststaymelsslrsedtavyycaregttgwgwlgkpigafqhwgqg tlvtvss
Timeline for d4odxh_: