Lineage for d4ob5h_ (4ob5 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754565Domain d4ob5h_: 4ob5 H: [260199]
    Other proteins in same PDB: d4ob5l2
    automated match to d3h3pi_
    complexed with gol, tmo

Details for d4ob5h_

PDB Entry: 4ob5 (more details), 1.7 Å

PDB Description: Ontogeny of recognition specificity and functionality for the broadly neutralizing anti-HIV antibody 4E10
PDB Compounds: (H:) 4E10 antibody germline precursor 7 heavy chain Fv

SCOPe Domain Sequences for d4ob5h_:

Sequence, based on SEQRES records: (download)

>d4ob5h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtanya
qkfqgrvtitadkststaymelsslrsedtavyycaregttgwgwlgkpigafqhwgqgt
lvtvs

Sequence, based on observed residues (ATOM records): (download)

>d4ob5h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkkpgssvkvsckastfssyaiswvrqapgqglewmggiipifgtanyaqk
fqgrvtitadkststaymelsslrsedtavyycaregttggwlgkpigafqhwgqgtlvt
vs

SCOPe Domain Coordinates for d4ob5h_:

Click to download the PDB-style file with coordinates for d4ob5h_.
(The format of our PDB-style files is described here.)

Timeline for d4ob5h_: