Lineage for d4nqlb_ (4nql B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538652Protein Ubiquitin [54238] (9 species)
  7. 2539434Species Mouse (Mus musculus) [TaxId:10090] [190020] (9 PDB entries)
  8. 2539455Domain d4nqlb_: 4nql B: [260196]
    automated match to d3dvgy_
    complexed with edo, zn

Details for d4nqlb_

PDB Entry: 4nql (more details), 2.3 Å

PDB Description: The crystal structure of the DUB domain of AMSH orthologue, Sst2 from S. pombe, in complex with lysine 63-linked diubiquitin
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d4nqlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nqlb_ d.15.1.1 (B:) Ubiquitin {Mouse (Mus musculus) [TaxId: 10090]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d4nqlb_:

Click to download the PDB-style file with coordinates for d4nqlb_.
(The format of our PDB-style files is described here.)

Timeline for d4nqlb_: