Lineage for d4npea_ (4npe A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309262Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2309263Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2309264Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 protein domains)
    automatically mapped to Pfam PF02216
  6. 2309358Protein automated matches [191290] (5 species)
    not a true protein
  7. 2309366Species Staphylococcus aureus [TaxId:1280] [189943] (16 PDB entries)
  8. 2309369Domain d4npea_: 4npe A: [260194]
    automated match to d1bdca_
    complexed with scn, zn

Details for d4npea_

PDB Entry: 4npe (more details), 1.42 Å

PDB Description: high-resolution structure of c domain of staphylococcal protein a at room temperature
PDB Compounds: (A:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4npea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4npea_ a.8.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
adnkfnkeqqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqapk

SCOPe Domain Coordinates for d4npea_:

Click to download the PDB-style file with coordinates for d4npea_.
(The format of our PDB-style files is described here.)

Timeline for d4npea_: