Lineage for d4npfy1 (4npf Y:1-58)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310325Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2310326Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2310327Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2310424Protein automated matches [191290] (5 species)
    not a true protein
  7. 2310432Species Staphylococcus aureus [TaxId:1280] [189943] (19 PDB entries)
  8. 2310438Domain d4npfy1: 4npf Y:1-58 [260192]
    automated match to d1h0ta_

Details for d4npfy1

PDB Entry: 4npf (more details), 1.49 Å

PDB Description: high-resolution structure of two tandem b domains of staphylococcal protein a connected by the conserved linker
PDB Compounds: (Y:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4npfy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4npfy1 a.8.1.1 (Y:1-58) automated matches {Staphylococcus aureus [TaxId: 1280]}
adnkfnkeqqnawyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapk

SCOPe Domain Coordinates for d4npfy1:

Click to download the PDB-style file with coordinates for d4npfy1.
(The format of our PDB-style files is described here.)

Timeline for d4npfy1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4npfy2