Lineage for d4n4yb1 (4n4y B:3-40)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252855Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2252897Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2252898Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2252918Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)
  7. 2252919Species Thermus thermophilus [TaxId:274] [81459] (23 PDB entries)
    the "missing" first helix is complemented by the ba3 subunit IIa
  8. 2252939Domain d4n4yb1: 4n4y B:3-40 [260187]
    Other proteins in same PDB: d4n4ya_, d4n4yb2, d4n4yc_
    automated match to d1ehkb2
    complexed with cu, cua, has, hem, olc, peo; mutant

Details for d4n4yb1

PDB Entry: 4n4y (more details), 2.9 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant G232V from Thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d4n4yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n4yb1 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiaytlath

SCOPe Domain Coordinates for d4n4yb1:

Click to download the PDB-style file with coordinates for d4n4yb1.
(The format of our PDB-style files is described here.)

Timeline for d4n4yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n4yb2