Lineage for d4n46b1 (4n46 B:1-269)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881785Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1881786Protein automated matches [196909] (52 species)
    not a true protein
  7. 1881902Species Clostridium acetobutylicum [TaxId:863638] [260180] (5 PDB entries)
  8. 1881905Domain d4n46b1: 4n46 B:1-269 [260181]
    automated match to d4dd5a1
    complexed with act, coa

Details for d4n46b1

PDB Entry: 4n46 (more details), 1.39 Å

PDB Description: crystal structure of thiolase from clostridium acetobutylicum in complex with coa
PDB Compounds: (B:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4n46b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n46b1 c.95.1.0 (B:1-269) automated matches {Clostridium acetobutylicum [TaxId: 863638]}
mkevviasavrtaigsygkslkdvpavdlgataikeavkkagikpedvnevilgnvlqag
lgqnparqasfkaglpveipamtinkvcgsglrtvslaaqiikagdadviiaggmenmsr
apylannarwgyrmgnakfvdemitdglwdafndyhmgitaeniaerwnisreeqdefal
asqkkaeeaiksgqfkdeivpvvikgrkgetvvdtdehprfgstieglaklkpafkkdgt
vtagnasglndcaavlvimsaekakelgv

SCOPe Domain Coordinates for d4n46b1:

Click to download the PDB-style file with coordinates for d4n46b1.
(The format of our PDB-style files is described here.)

Timeline for d4n46b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n46b2