Lineage for d1gg6.1 (1gg6 A:,B:,C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298675Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 298676Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 298774Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins)
  6. 298775Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 298776Species Cow (Bos taurus) [TaxId:9913] [50523] (46 PDB entries)
  8. 298777Domain d1gg6.1: 1gg6 A:,B:,C: [26018]
    complexed with apf, apl, edo, so4

Details for d1gg6.1

PDB Entry: 1gg6 (more details), 1.4 Å

PDB Description: crystal structure of gamma chymotrypsin with n-acetyl-phenylalanine trifluoromethyl ketone bound at the active site

SCOP Domain Sequences for d1gg6.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1gg6.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicaga
sgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOP Domain Coordinates for d1gg6.1:

Click to download the PDB-style file with coordinates for d1gg6.1.
(The format of our PDB-style files is described here.)

Timeline for d1gg6.1: