SCOPe 2.08: Domain d1gg6.1: 1gg6 A:,B:,C:

Lineage for d1gg6.1 (1gg6 A:,B:,C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
   Uniprot P00766

8. Domain d1gg6.1: 1gg6 A:,B:,C: [26018]
   complexed with apf, apl, edo, so4

Details for d1gg6.1

PDB Entry: 1gg6, 1.4 Å

PDB Description: crystal structure of gamma chymotrypsin with n-acetyl-phenylalanine trifluoromethyl ketone bound at the active site

PDB Compounds: (A:) gamma chymotrypsin, (B:) gamma chymotrypsin, (C:) gamma chymotrypsin

SCOPe Domain Sequences for d1gg6.1:

Sequence; same for both SEQRES and ATOM records:

>g1gg6.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicaga
sgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

Timeline for d1gg6.1:

• d1gg6.1 first appeared (with stable ids) in SCOP 1.55
  
• d1gg6.1 appears in SCOPe 2.07