Lineage for d4n1hc_ (4n1h C:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013570Species Bacillus licheniformis [TaxId:1402] [188244] (18 PDB entries)
  8. 3013605Domain d4n1hc_: 4n1h C: [260179]
    Other proteins in same PDB: d4n1hb1, d4n1hb2, d4n1hb3, d4n1hd1, d4n1hd2, d4n1hd3
    automated match to d2blma_

Details for d4n1hc_

PDB Entry: 4n1h (more details), 3 Å

PDB Description: Structure of a single-domain camelid antibody fragment cAb-F11N in complex with the BlaP beta-lactamase from Bacillus licheniformis
PDB Compounds: (C:) Beta-lactamase

SCOPe Domain Sequences for d4n1hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n1hc_ e.3.1.1 (C:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralvtslrafaledpgklpsekrellidwm
krnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdak
yddkliaeatkvvmkaln

SCOPe Domain Coordinates for d4n1hc_:

Click to download the PDB-style file with coordinates for d4n1hc_.
(The format of our PDB-style files is described here.)

Timeline for d4n1hc_: