Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein automated matches [190161] (29 species) not a true protein |
Species Bacillus licheniformis [TaxId:1402] [188244] (18 PDB entries) |
Domain d4n1hc_: 4n1h C: [260179] Other proteins in same PDB: d4n1hb1, d4n1hb2, d4n1hb3, d4n1hd1, d4n1hd2, d4n1hd3 automated match to d2blma_ |
PDB Entry: 4n1h (more details), 3 Å
SCOPe Domain Sequences for d4n1hc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n1hc_ e.3.1.1 (C:) automated matches {Bacillus licheniformis [TaxId: 1402]} ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr kigdevtnperfepelnevnpgetqdtstaralvtslrafaledpgklpsekrellidwm krnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdak yddkliaeatkvvmkaln
Timeline for d4n1hc_: