SCOPe 2.08: Domain d4mn9a_: 4mn9 A:

Lineage for d4mn9a_ (4mn9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries)

8. Domain d4mn9a_: 4mn9 A: [260175]
   automated match to d3shxa_
   complexed with cl, fe, mg; mutant

Details for d4mn9a_

PDB Entry: 4mn9, 1.15 Å

PDB Description: fifteen minutes iron loaded frog m ferritin mutant h54q

PDB Compounds: (A:) Ferritin, middle subunit

SCOPe Domain Sequences for d4mn9a_:

Sequence; same for both SEQRES and ATOM records:

>d4mn9a_ a.25.1.1 (A:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkeqsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvke

Timeline for d4mn9a_:

• d4mn9a_ first appeared in SCOPe 2.04
  
• d4mn9a_ appears in SCOPe 2.07