SCOPe 2.05: Domain d4lrnh_: 4lrn H:

Lineage for d4lrnh_ (4lrn H:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4lrnh_: 4lrn H: [260170]
   automated match to d3h3pi_

Details for d4lrnh_

PDB Entry: 4lrn, 1.89 Å

PDB Description: Ontogeny of recognition specificity and functionality for the anti-HIV antibody 4E10

PDB Compounds: (H:) GEP 1 heavy chain

SCOPe Domain Sequences for d4lrnh_:

Sequence, based on SEQRES records:

>d4lrnh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtanyaq
kfqgrvtitadkststaymelsslrsedtavyycaregttgwgwlgkpigafaywgqgtl
vtvss

Sequence, based on observed residues (ATOM records):

>d4lrnh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlvqsgaevkkpgssvkvsckasaiswvrqapgqglewmggiipifgtanyaqkfqgrvt
itadkststaymelsslrsedtavyycareggwlgkpigafaywgqgtlvtvss

Timeline for d4lrnh_:

• d4lrnh_ first appeared in SCOPe 2.04
  
• d4lrnh_ appears in SCOPe 2.06
  
• d4lrnh_ appears in the current release, SCOPe 2.08