Lineage for d4lrnh_ (4lrn H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754908Domain d4lrnh_: 4lrn H: [260170]
    automated match to d3h3pi_

Details for d4lrnh_

PDB Entry: 4lrn (more details), 1.89 Å

PDB Description: Ontogeny of recognition specificity and functionality for the anti-HIV antibody 4E10
PDB Compounds: (H:) GEP 1 heavy chain

SCOPe Domain Sequences for d4lrnh_:

Sequence, based on SEQRES records: (download)

>d4lrnh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtanyaq
kfqgrvtitadkststaymelsslrsedtavyycaregttgwgwlgkpigafaywgqgtl
vtvss

Sequence, based on observed residues (ATOM records): (download)

>d4lrnh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlvqsgaevkkpgssvkvsckasaiswvrqapgqglewmggiipifgtanyaqkfqgrvt
itadkststaymelsslrsedtavyycareggwlgkpigafaywgqgtlvtvss

SCOPe Domain Coordinates for d4lrnh_:

Click to download the PDB-style file with coordinates for d4lrnh_.
(The format of our PDB-style files is described here.)

Timeline for d4lrnh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4lrnl_