Lineage for d1try__ (1try -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) Species Mold (Fusarium oxysporum) [TaxId:5507] [50521] (7 PDB entries) 
Domain d1try__: 1try - [26017]
Details for d1try__
PDB Entry: 1try (more details), 1.55 Å
PDB Description: structure of inhibited trypsin from fusarium oxysporum at 1.55 angstroms
SCOP Domain Sequences for d1try__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1try__ b.47.1.2 (-) Trypsin(ogen) {Mold (Fusarium oxysporum)}
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya
SCOP Domain Coordinates for d1try__:
Click to download the PDB-style file with coordinates for d1try__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1try__:
- d1try__ appears in SCOP 1.57
- d1try__ appears in the current release, SCOPe 2.08, called d1trya_
View in 3D