Lineage for d4cpoa_ (4cpo A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065266Protein automated matches [193245] (14 species)
    not a true protein
  7. 2065338Species Influenza B virus [TaxId:11520] [256642] (3 PDB entries)
  8. 2065341Domain d4cpoa_: 4cpo A: [260160]
    automated match to d1infa_
    complexed with ca, edo, nag

Details for d4cpoa_

PDB Entry: 4cpo (more details), 2.2 Å

PDB Description: Structure of the Neuraminidase from the B/Lyon/CHU/15.216/2011 virus
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4cpoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpoa_ b.68.1.1 (A:) automated matches {Influenza B virus [TaxId: 11520]}
epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
twhsaataiyclmgsgqllwdtvtgvdmal

SCOPe Domain Coordinates for d4cpoa_:

Click to download the PDB-style file with coordinates for d4cpoa_.
(The format of our PDB-style files is described here.)

Timeline for d4cpoa_: