SCOPe 2.06: Domain d4cnob_: 4cno B:

Lineage for d4cnob_ (4cno B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Type I 3-dehydroquinate dehydratase [51586] (4 species)

7. Species Salmonella enterica [TaxId:90370] [260153] (5 PDB entries)

8. Domain d4cnob_: 4cno B: [260154]
   automated match to d1gqna_
   complexed with 9py

Details for d4cnob_

PDB Entry: 4cno, 1.5 Å

PDB Description: structure of the salmonella typhi type i dehydroquinase inhibited by a 3-dehydroquinic acid derivative

PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4cnob_:

Sequence, based on SEQRES records:

>d4cnob_ c.1.10.1 (B:) Type I 3-dehydroquinate dehydratase {Salmonella enterica [TaxId: 90370]}
ktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqsv
ltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftgd
advkatvdyahahnvyvvmsnhdfhqtpsaeemvlrlrkmqalgadipkiavmpqskhdv
ltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkqasapgqiavnd
lrsvlmilhna

Sequence, based on observed residues (ATOM records):

>d4cnob_ c.1.10.1 (B:) Type I 3-dehydroquinate dehydratase {Salmonella enterica [TaxId: 90370]}
ktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqsv
ltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftgd
advkatvdyahahnvyvvmsnhdfhqtpsaeemvlrlrkmqalgadipkiavmpqskhdv
ltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkpgqiavndlrsv
lmilhna

Timeline for d4cnob_:

• d4cnob_ first appeared in SCOPe 2.04
  
• d4cnob_ appears in SCOPe 2.05
  
• d4cnob_ appears in SCOPe 2.07
  
• d4cnob_ appears in the current release, SCOPe 2.08