Lineage for d4ck4b_ (4ck4 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2062523Family b.60.1.1: Retinol binding protein-like [50815] (22 protein domains)
    barrel, closed; n=8, S=12, meander
  6. 2062960Protein automated matches [190163] (13 species)
    not a true protein
  7. 2063043Species Sheep (Ovis aries) [TaxId:9940] [237679] (4 PDB entries)
  8. 2063045Domain d4ck4b_: 4ck4 B: [260151]
    automated match to d4nlja_
    complexed with act, cl, na, nh4, so4

Details for d4ck4b_

PDB Entry: 4ck4 (more details), 1.12 Å

PDB Description: ovine beta-lactoglobulin at atomic resolution
PDB Compounds: (B:) beta_lactoglobulin-1/b

SCOPe Domain Sequences for d4ck4b_:

Sequence, based on SEQRES records: (download)

>d4ck4b_ b.60.1.1 (B:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
iivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevdnealekfdkalkalpmhirlafnptqlegqchv

Sequence, based on observed residues (ATOM records): (download)

>d4ck4b_ b.60.1.1 (B:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
iivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillqk
wegecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevdnealekfdkalkalpmhirlafnptqlegqchv

SCOPe Domain Coordinates for d4ck4b_:

Click to download the PDB-style file with coordinates for d4ck4b_.
(The format of our PDB-style files is described here.)

Timeline for d4ck4b_: