Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries) |
Domain d4c2za1: 4c2z A:115-295 [260149] automated match to d3iu1a1 complexed with 646, cit, cl, gol, mg, mya |
PDB Entry: 4c2z (more details), 2.08 Å
SCOPe Domain Sequences for d4c2za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2za1 d.108.1.0 (A:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]} rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc r
Timeline for d4c2za1: