![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.16: Lipase [53555] (2 proteins) |
![]() | Protein automated matches [254730] (4 species) not a true protein |
![]() | Species Thermobifida alba [TaxId:53522] [256136] (3 PDB entries) |
![]() | Domain d3wynb_: 3wyn B: [260138] automated match to d3visa_ complexed with 2pe, ca |
PDB Entry: 3wyn (more details), 1.68 Å
SCOPe Domain Sequences for d3wynb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wynb_ c.69.1.16 (B:) automated matches {Thermobifida alba [TaxId: 53522]} anpyergpnptesmlearsgpfsvseerasrfgadgfgggtiyyprenntygaiaispgy tgtqssiawlgeriashgfvviaidtnttldqpdsrarqlnaaldymltdassavrnrid asrlavmghsmggggtlrlasqrpdlkaaipltpwhlnkswrditvptliigaeydtias vtlhskpfynsipsptdkayleldgashfapnitnktigmysvawlkrfvdedtrytqfl cpgprtgllsdveeyrstcpf
Timeline for d3wynb_: