SCOP 1.75: Domain d1fy4a_: 1fy4 A:

Lineage for d1fy4a_ (1fy4 A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Mold (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries)

8. Domain d1fy4a_: 1fy4 A: [26013]
   complexed with gol, so4

Details for d1fy4a_

PDB Entry: 1fy4, 0.81 Å

PDB Description: fusarium oxysporum trypsin at atomic resolution

PDB Compounds: (A:) Trypsin

SCOP Domain Sequences for d1fy4a_:

Sequence; same for both SEQRES and ATOM records:

>d1fy4a_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]}
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya

Timeline for d1fy4a_:

• d1fy4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fy4a_ appears in SCOP 1.73
  
• d1fy4a_ appears in SCOPe 2.01
  
• d1fy4a_ appears in the current release, SCOPe 2.08