Lineage for d4weea1 (4wee A:140-265)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2368400Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2368401Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2368554Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 protein domains)
    topologically similar to the C-terminal domain of PapD
  6. 2368580Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2368600Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (11 PDB entries)
    Uniprot P21707 271-419 ! Uniprot P21707 271-419
  8. 2368603Domain d4weea1: 4wee A:140-265 [260125]
    Other proteins in same PDB: d4weea2
    automated match to d3f04a_
    complexed with na, so4

Details for d4weea1

PDB Entry: 4wee (more details), 0.89 Å

PDB Description: high-resolution structure of synaptotagmin 1 c2a
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d4weea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4weea1 b.7.1.2 (A:140-265) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsa

SCOPe Domain Coordinates for d4weea1:

Click to download the PDB-style file with coordinates for d4weea1.
(The format of our PDB-style files is described here.)

Timeline for d4weea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4weea2