SCOPe 2.05: Domain d4wbsa_: 4wbs A:

Lineage for d4wbsa_ (4wbs A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Burkholderia phymatum [TaxId:391038] [260120] (1 PDB entry)

8. Domain d4wbsa_: 4wbs A: [260121]
   automated match to d2d2fa_
   complexed with cl

Details for d4wbsa_

PDB Entry: 4wbs, 2 Å

PDB Description: crystal structure of an abc transporter related protein from burkholderia phymatum

PDB Compounds: (A:) ABC transporter related

SCOPe Domain Sequences for d4wbsa_:

Sequence; same for both SEQRES and ATOM records:

>d4wbsa_ c.37.1.0 (A:) automated matches {Burkholderia phymatum [TaxId: 391038]}
ssslvvrnlkkrygsrtvvkdvsldvksgevvgllgpngagkttsfymivglvpldagei
dldgksisllpihkraslglsylpqeasvfrklsveeniravlelqvgddgkrlskdaia
srtealldelqishlrenpalslsggerrrveiaralatnpsfilldepfagvdpiavle
iqkivkflkqrnigvlitdhnvretlgicdhayiisdgsvlaagapgdiienesvrrvyl
gehfrm

Timeline for d4wbsa_:

• d4wbsa_ first appeared in SCOPe 2.04
  
• d4wbsa_ appears in SCOPe 2.06
  
• d4wbsa_ appears in the current release, SCOPe 2.08