Lineage for d4wbsa_ (4wbs A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871738Species Burkholderia phymatum [TaxId:391038] [260120] (1 PDB entry)
  8. 2871739Domain d4wbsa_: 4wbs A: [260121]
    automated match to d2d2fa_
    complexed with cl

Details for d4wbsa_

PDB Entry: 4wbs (more details), 2 Å

PDB Description: crystal structure of an abc transporter related protein from burkholderia phymatum
PDB Compounds: (A:) ABC transporter related

SCOPe Domain Sequences for d4wbsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wbsa_ c.37.1.0 (A:) automated matches {Burkholderia phymatum [TaxId: 391038]}
ssslvvrnlkkrygsrtvvkdvsldvksgevvgllgpngagkttsfymivglvpldagei
dldgksisllpihkraslglsylpqeasvfrklsveeniravlelqvgddgkrlskdaia
srtealldelqishlrenpalslsggerrrveiaralatnpsfilldepfagvdpiavle
iqkivkflkqrnigvlitdhnvretlgicdhayiisdgsvlaagapgdiienesvrrvyl
gehfrm

SCOPe Domain Coordinates for d4wbsa_:

Click to download the PDB-style file with coordinates for d4wbsa_.
(The format of our PDB-style files is described here.)

Timeline for d4wbsa_: