SCOPe 2.08: Domain d4wb4a_: 4wb4 A:

Lineage for d4wb4a_ (4wb4 A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families)
   not a true superfamily

5. Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins)

6. Protein automated matches [254616] (6 species)
   not a true protein

7. Species Simian rotavirus a/sa11 [TaxId:10923] [260113] (2 PDB entries)

8. Domain d4wb4a_: 4wb4 A: [260117]
   automated match to d2o1ja_
   complexed with ca

Details for d4wb4a_

PDB Entry: 4wb4, 2.03 Å

PDB Description: wt sa11 nsp4_ccd

PDB Compounds: (A:) non-structural glycoprotein nsp4

SCOPe Domain Sequences for d4wb4a_:

Sequence; same for both SEQRES and ATOM records:

>d4wb4a_ h.1.13.1 (A:) automated matches {Simian rotavirus a/sa11 [TaxId: 10923]}
ekqmdrvvkemrrqlemidklttreieqvellkriydkltv

Timeline for d4wb4a_:

• d4wb4a_ first appeared in SCOPe 2.04
  
• d4wb4a_ appears in SCOPe 2.07