SCOPe 2.08: Domain d4w9sa1: 4w9s A:1-195

Lineage for d4w9sa1 (4w9s A:1-195)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (8 species)

7. Species Influenza A virus [TaxId:387207] [260115] (1 PDB entry)

8. Domain d4w9sa1: 4w9s A:1-195 [260116]
   Other proteins in same PDB: d4w9sa2
   automated match to d4ln7a_
   protein/RNA complex; complexed with 3k1, mn, so4

Details for d4w9sa1

PDB Entry: 4w9s, 1.8 Å

PDB Description: 2-(4-(1H-tetrazol-5-yl)phenyl)-5-hydroxypyrimidin-4(3H)-one bound to influenza 2009 H1N1 endonuclease

PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d4w9sa1:

Sequence; same for both SEQRES and ATOM records:

>d4w9sa1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza A virus [TaxId: 387207]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfiderges
iivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfiei
gvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirq
emasrslwdsfrqse

Timeline for d4w9sa1:

• d4w9sa1 first appeared in SCOPe 2.04, called d4w9sa_
  
• d4w9sa1 appears in SCOPe 2.07