Lineage for d1gdna_ (1gdn A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15329Protein Trypsin(ogen) [50515] (6 species)
  7. 15464Species Mold (Fusarium oxysporum) [TaxId:5507] [50521] (7 PDB entries)
  8. 15465Domain d1gdna_: 1gdn A: [26011]

Details for d1gdna_

PDB Entry: 1gdn (more details), 0.81 Å

PDB Description: fusarium oxysporum trypsin at atomic resolution

SCOP Domain Sequences for d1gdna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum)}
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya

SCOP Domain Coordinates for d1gdna_:

Click to download the PDB-style file with coordinates for d1gdna_.
(The format of our PDB-style files is described here.)

Timeline for d1gdna_: