SCOPe 2.05: Domain d4w4la_: 4w4l A:

Lineage for d4w4la_ (4w4l A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle

5. Family a.25.4.1: PE [140460] (2 proteins)
   Pfam PF00934; pairs with with the N-terminal hairpin of PPE

6. Protein automated matches [256919] (2 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:652616] [260105] (2 PDB entries)

8. Domain d4w4la_: 4w4l A: [260108]
   Other proteins in same PDB: d4w4lb_
   automated match to d2g38a1
   complexed with edo

Details for d4w4la_

PDB Entry: 4w4l, 2.45 Å

PDB Description: crystal structure of espg5 in complex with pe25 and ppe41 from the esx-5 type vii secretion system of m. tuberculosis

PDB Compounds: (A:) PE family protein PE25

SCOPe Domain Sequences for d4w4la_:

Sequence; same for both SEQRES and ATOM records:

>d4w4la_ a.25.4.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 652616]}
npealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyarkyrqti
aaaavvleefahalttgadkyata

Timeline for d4w4la_:

• d4w4la_ first appeared in SCOPe 2.04
  
• d4w4la_ appears in SCOPe 2.06
  
• d4w4la_ appears in the current release, SCOPe 2.08