| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families) ![]() (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle |
| Family a.25.4.1: PE [140460] (2 proteins) Pfam PF00934; pairs with with the N-terminal hairpin of PPE |
| Protein automated matches [256919] (2 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:652616] [260105] (2 PDB entries) |
| Domain d4w4kc_: 4w4k C: [260106] Other proteins in same PDB: d4w4kb_, d4w4kd_ automated match to d2g38a1 |
PDB Entry: 4w4k (more details), 1.95 Å
SCOPe Domain Sequences for d4w4kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w4kc_ a.25.4.1 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 652616]}
npealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyarkyrqti
aaaavvleefahalttg
Timeline for d4w4kc_: