Lineage for d4w4kc_ (4w4k C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705398Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle
  5. 2705399Family a.25.4.1: PE [140460] (2 proteins)
    Pfam PF00934; pairs with with the N-terminal hairpin of PPE
  6. 2705404Protein automated matches [256919] (2 species)
    not a true protein
  7. 2705405Species Mycobacterium tuberculosis [TaxId:652616] [260105] (2 PDB entries)
  8. 2705407Domain d4w4kc_: 4w4k C: [260106]
    Other proteins in same PDB: d4w4kb_, d4w4kd_
    automated match to d2g38a1

Details for d4w4kc_

PDB Entry: 4w4k (more details), 1.95 Å

PDB Description: crystal structure of a pe25-ppe41 heterodimer from a type vii secretion system of m. tuberculosis
PDB Compounds: (C:) PE family protein PE25

SCOPe Domain Sequences for d4w4kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w4kc_ a.25.4.1 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 652616]}
npealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyarkyrqti
aaaavvleefahalttg

SCOPe Domain Coordinates for d4w4kc_:

Click to download the PDB-style file with coordinates for d4w4kc_.
(The format of our PDB-style files is described here.)

Timeline for d4w4kc_: