Class b: All beta proteins [48724] (176 folds) |
Fold b.132: Supernatant protein factor (SPF), C-terminal domain [101575] (1 superfamily) sandwich; 8 strands in 2 sheets; jelly-roll; similarity to the Nucleoplasmin-like/VP fold |
Superfamily b.132.1: Supernatant protein factor (SPF), C-terminal domain [101576] (2 families) |
Family b.132.1.0: automated matches [258521] (1 protein) not a true family |
Protein automated matches [258522] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [258523] (2 PDB entries) |
Domain d4uyba3: 4uyb A:275-400 [260103] Other proteins in same PDB: d4uyba1, d4uyba2 automated match to d1o6ua2 complexed with edo, unl |
PDB Entry: 4uyb (more details), 1.5 Å
SCOPe Domain Sequences for d4uyba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uyba3 b.132.1.0 (A:275-400) automated matches {Human (Homo sapiens) [TaxId: 9606]} ktqyehsvqinrgsshqveyeilfpgcvlrwqfssdgadigfgvflktkmgerqragemt evlpsqrynahmvpedgnltcseagvyvlrfdntysfvhakkvsftvevllpdegmqkyd keltpv
Timeline for d4uyba3: