Lineage for d4uyba3 (4uyb A:275-400)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1814318Fold b.132: Supernatant protein factor (SPF), C-terminal domain [101575] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll; similarity to the Nucleoplasmin-like/VP fold
  4. 1814319Superfamily b.132.1: Supernatant protein factor (SPF), C-terminal domain [101576] (2 families) (S)
  5. 1814329Family b.132.1.0: automated matches [258521] (1 protein)
    not a true family
  6. 1814330Protein automated matches [258522] (1 species)
    not a true protein
  7. 1814331Species Human (Homo sapiens) [TaxId:9606] [258523] (2 PDB entries)
  8. 1814332Domain d4uyba3: 4uyb A:275-400 [260103]
    Other proteins in same PDB: d4uyba1, d4uyba2
    automated match to d1o6ua2
    complexed with edo, unl

Details for d4uyba3

PDB Entry: 4uyb (more details), 1.5 Å

PDB Description: crystal structure of sec14-like protein 3
PDB Compounds: (A:) sec14-like protein 3

SCOPe Domain Sequences for d4uyba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uyba3 b.132.1.0 (A:275-400) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktqyehsvqinrgsshqveyeilfpgcvlrwqfssdgadigfgvflktkmgerqragemt
evlpsqrynahmvpedgnltcseagvyvlrfdntysfvhakkvsftvevllpdegmqkyd
keltpv

SCOPe Domain Coordinates for d4uyba3:

Click to download the PDB-style file with coordinates for d4uyba3.
(The format of our PDB-style files is described here.)

Timeline for d4uyba3: