SCOPe 2.04: Domain d4uyba2: 4uyb A:76-274

Lineage for d4uyba2 (4uyb A:76-274)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families)
   automatically mapped to Pfam PF00650

5. Family c.13.1.0: automated matches [227225] (1 protein)
   not a true family

6. Protein automated matches [226966] (2 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [258518] (2 PDB entries)

8. Domain d4uyba2: 4uyb A:76-274 [260102]
   Other proteins in same PDB: d4uyba1, d4uyba3
   automated match to d1olma3
   complexed with edo, unl

Details for d4uyba2

PDB Entry: 4uyb, 1.5 Å

PDB Description: crystal structure of sec14-like protein 3

PDB Compounds: (A:) sec14-like protein 3

SCOPe Domain Sequences for d4uyba2:

Sequence; same for both SEQRES and ATOM records:

>d4uyba2 c.13.1.0 (A:76-274) automated matches {Homo sapiens [TaxId: 9606]}
ppeviqkympgglcgydrdgcpvwydiigpldpkgllfsvtkqdllktkmrdcerilhec
dlqterlgkkietivmifdceglglkhfwkplvevyqeffglleenypetlkfmlivkat
klfpvgynlmkpflsedtrrkiivlgnnwkegllklispeelpaqfggtltdpdgnpkcl
tkinyggeipksmyvrdqv

Timeline for d4uyba2:

• d4uyba2 is new in SCOPe 2.04-stable
  
• d4uyba2 appears in SCOPe 2.05
  
• d4uyba2 appears in the current release, SCOPe 2.08