SCOPe 2.06: Domain d4uyba1: 4uyb A:1-75

Lineage for d4uyba1 (4uyb A:1-75)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families)

5. Family a.5.3.0: automated matches [227224] (1 protein)
   not a true family

6. Protein automated matches [226965] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [258515] (4 PDB entries)

8. Domain d4uyba1: 4uyb A:1-75 [260101]
   Other proteins in same PDB: d4uyba2, d4uyba3, d4uyba4
   automated match to d1olma1
   complexed with edo, unl

Details for d4uyba1

PDB Entry: 4uyb, 1.5 Å

PDB Description: crystal structure of sec14-like protein 3

PDB Compounds: (A:) sec14-like protein 3

SCOPe Domain Sequences for d4uyba1:

Sequence; same for both SEQRES and ATOM records:

>d4uyba1 a.5.3.0 (A:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msgrvgdlspkqaetlakfrenvqdvlpalpnpddyfllrwlrarnfdlqkseallrkym
efrktmdidhildwq

Timeline for d4uyba1:

• d4uyba1 first appeared in SCOPe 2.04
  
• d4uyba1 appears in SCOPe 2.05
  
• d4uyba1 appears in SCOPe 2.07
  
• d4uyba1 appears in the current release, SCOPe 2.08