Lineage for d4uyba1 (4uyb A:0-75)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1480920Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1481125Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) (S)
  5. 1481144Family a.5.3.0: automated matches [227224] (1 protein)
    not a true family
  6. 1481145Protein automated matches [226965] (3 species)
    not a true protein
  7. 1481153Species Homo sapiens [TaxId:9606] [258515] (2 PDB entries)
  8. 1481154Domain d4uyba1: 4uyb A:0-75 [260101]
    Other proteins in same PDB: d4uyba2, d4uyba3
    automated match to d1olma1
    complexed with edo, unl

Details for d4uyba1

PDB Entry: 4uyb (more details), 1.5 Å

PDB Description: crystal structure of sec14-like protein 3
PDB Compounds: (A:) sec14-like protein 3

SCOPe Domain Sequences for d4uyba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uyba1 a.5.3.0 (A:0-75) automated matches {Homo sapiens [TaxId: 9606]}
smsgrvgdlspkqaetlakfrenvqdvlpalpnpddyfllrwlrarnfdlqkseallrky
mefrktmdidhildwq

SCOPe Domain Coordinates for d4uyba1:

Click to download the PDB-style file with coordinates for d4uyba1.
(The format of our PDB-style files is described here.)

Timeline for d4uyba1: