Lineage for d4uy2c_ (4uy2 C:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702133Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1702134Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1702135Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 1702166Protein Bungarotoxin [57324] (4 species)
  7. 1702167Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (23 PDB entries)
  8. 1702171Domain d4uy2c_: 4uy2 C: [260099]
    automated match to d1hc9a_
    complexed with nag

Details for d4uy2c_

PDB Entry: 4uy2 (more details), 2.7 Å

PDB Description: Crystal structure of the complex of the extracellular domain of human alpha9 nAChR with alpha-bungarotoxin.
PDB Compounds: (C:) alpha-bungarotoxin isoform v31

SCOPe Domain Sequences for d4uy2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uy2c_ g.7.1.1 (C:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrp

SCOPe Domain Coordinates for d4uy2c_:

Click to download the PDB-style file with coordinates for d4uy2c_.
(The format of our PDB-style files is described here.)

Timeline for d4uy2c_: