Lineage for d4uu1a4 (4uu1 A:361-599)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1945321Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 1945322Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 1945323Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 1945324Protein Calcium ATPase [81658] (1 species)
  7. 1945325Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (40 PDB entries)
    Uniprot P04191
  8. 1945368Domain d4uu1a4: 4uu1 A:361-599 [260098]
    Other proteins in same PDB: d4uu1a1, d4uu1a2, d4uu1a3
    automated match to d1wpga3
    complexed with acp, gol, k, mg, pcw, tg1

Details for d4uu1a4

PDB Entry: 4uu1 (more details), 2.8 Å

PDB Description: crystal structure of (sr) calcium-atpase e2(tg) in the presence of dopc
PDB Compounds: (A:) sarcoplasmic endoplasmic reticulum calcium ATPase

SCOPe Domain Sequences for d4uu1a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uu1a4 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOPe Domain Coordinates for d4uu1a4:

Click to download the PDB-style file with coordinates for d4uu1a4.
(The format of our PDB-style files is described here.)

Timeline for d4uu1a4: