Lineage for d4uu1a3 (4uu1 A:344-360,A:600-750)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1628784Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (2 proteins)
    interrupted by a large insertion, domain N
  6. 1628785Protein Calcium ATPase, catalytic domain P [81655] (1 species)
  7. 1628786Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (39 PDB entries)
    Uniprot P04191
  8. 1628829Domain d4uu1a3: 4uu1 A:344-360,A:600-750 [260097]
    Other proteins in same PDB: d4uu1a1, d4uu1a2, d4uu1a4
    automated match to d1wpga2
    complexed with acp, gol, k, mg, pcw, tg1

Details for d4uu1a3

PDB Entry: 4uu1 (more details), 2.8 Å

PDB Description: crystal structure of (sr) calcium-atpase e2(tg) in the presence of dopc
PDB Compounds: (A:) sarcoplasmic endoplasmic reticulum calcium ATPase

SCOPe Domain Sequences for d4uu1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uu1a3 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

SCOPe Domain Coordinates for d4uu1a3:

Click to download the PDB-style file with coordinates for d4uu1a3.
(The format of our PDB-style files is described here.)

Timeline for d4uu1a3: