Lineage for d4uu0a2 (4uu0 A:125-239)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082621Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 2082622Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins)
  6. 2082623Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 2082624Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (43 PDB entries)
    Uniprot P04191
  8. 2082651Domain d4uu0a2: 4uu0 A:125-239 [260092]
    Other proteins in same PDB: d4uu0a1, d4uu0a3, d4uu0a4
    automated match to d1wpga1
    complexed with gol, k, mg, so4, tbu, tg1

Details for d4uu0a2

PDB Entry: 4uu0 (more details), 2.5 Å

PDB Description: crystal structure of (sr) calcium-atpase e2(tg) in the presence of 14:1 pc
PDB Compounds: (A:) SERCA1a

SCOPe Domain Sequences for d4uu0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uu0a2 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOPe Domain Coordinates for d4uu0a2:

Click to download the PDB-style file with coordinates for d4uu0a2.
(The format of our PDB-style files is described here.)

Timeline for d4uu0a2: