Lineage for d2tbsa_ (2tbs A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405549Protein Trypsin(ogen) [50515] (9 species)
  7. 2405550Species Atlantic salmon (Salmo salar) [TaxId:8030] [50520] (11 PDB entries)
  8. 2405554Domain d2tbsa_: 2tbs A: [26009]
    complexed with ben, ca

Details for d2tbsa_

PDB Entry: 2tbs (more details), 1.8 Å

PDB Description: cold-adaption of enzymes: structural comparison between salmon and bovine trypsins
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d2tbsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tbsa_ b.47.1.2 (A:) Trypsin(ogen) {Atlantic salmon (Salmo salar) [TaxId: 8030]}
ivggyeckaysqahqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsdklqclnipilsysdcndsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifsdwltstmasy

SCOPe Domain Coordinates for d2tbsa_:

Click to download the PDB-style file with coordinates for d2tbsa_.
(The format of our PDB-style files is described here.)

Timeline for d2tbsa_: