Lineage for d2tbs__ (2tbs -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species North atlantic salmon (Salmo salar) [TaxId:8030] [50520] (6 PDB entries) 
Domain d2tbs__: 2tbs - [26009]
Details for d2tbs__
PDB Entry: 2tbs (more details), 1.8 Å
PDB Description: cold-adaption of enzymes: structural comparison between salmon and bovine trypsins
SCOP Domain Sequences for d2tbs__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tbs__ b.47.1.2 (-) Trypsin(ogen) {North atlantic salmon (Salmo salar)}
ivggyeckaysqahqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsdklqclnipilsysdcndsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifsdwltstmasy
SCOP Domain Coordinates for d2tbs__:
Click to download the PDB-style file with coordinates for d2tbs__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tbs__:
- d2tbs__ first appeared (with stable ids) in SCOP 1.55
- d2tbs__ appears in SCOP 1.59
- d2tbs__ appears in the current release, SCOPe 2.08, called d2tbsa_
View in 3D