SCOPe 2.06: Domain d4upda1: 4upd A:13-549

Lineage for d4upda1 (4upd A:13-549)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Ophiostoma piceae [TaxId:61273] [256199] (3 PDB entries)

8. Domain d4upda1: 4upd A:13-549 [260086]
   Other proteins in same PDB: d4upda2
   automated match to d4be4a_
   complexed with 7p9, nag, pge; mutant

Details for d4upda1

PDB Entry: 4upd, 2.4 Å

PDB Description: open conformation of o. piceae sterol esterase mutant i544w

PDB Compounds: (A:) sterol esterase

SCOPe Domain Sequences for d4upda1:

Sequence; same for both SEQRES and ATOM records:

>d4upda1 c.69.1.0 (A:13-549) automated matches {Ophiostoma piceae [TaxId: 61273]}
ttvnvnypegevvgvsvlgiesfrgvpfaqppvgnlrlkppvrytenigtkdttgigpsc
pqmylstgngellfqlvgnliniplfqtatlssedcltlniqrpagttsnsslpvlfwif
gggfelgtnqyydgidlltegislgepfifvainyrvggfgflggkeikadgssnlglld
qrialewvadniasfggdpskvtiwgesagsisvfdqmalyggnnkykgkalfrggimns
gsvvpaapvdgvkaqaiydhvvseagcagtsdtlaclrtvdytkfltavnsvpgivsyss
ialsylprpdgvvlidspeeivknkqyaavpmiigdqedegtlfavlpnnitstakivqy
fqdlyfynatkeqltafvntyptditagspfntgifnelypgfkrlaailgdmtftlarr
aflqlcsevnpdvpswsylasydygfpflgtfhatdilqvfygvlpnyasgsiqkyyinf
vttgdpnkgaavdiqwpqwsakknilqiyatkavivadnfraksyeylynnwgifri

Timeline for d4upda1:

• d4upda1 first appeared in SCOPe 2.04, called d4upda_
  
• d4upda1 was called d4upda_ in SCOPe 2.05
  
• d4upda1 appears in SCOPe 2.07
  
• d4upda1 appears in the current release, SCOPe 2.08