Lineage for d4upda1 (4upd A:13-549)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (103 species)
    not a true protein
  7. 2477000Species Ophiostoma piceae [TaxId:61273] [256199] (3 PDB entries)
  8. 2477004Domain d4upda1: 4upd A:13-549 [260086]
    Other proteins in same PDB: d4upda2
    automated match to d4be4a_
    complexed with 7p9, nag, pge; mutant

Details for d4upda1

PDB Entry: 4upd (more details), 2.4 Å

PDB Description: Open conformation of O. piceae sterol esterase mutant I544W
PDB Compounds: (A:) sterol esterase

SCOPe Domain Sequences for d4upda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4upda1 c.69.1.0 (A:13-549) automated matches {Ophiostoma piceae [TaxId: 61273]}
ttvnvnypegevvgvsvlgiesfrgvpfaqppvgnlrlkppvrytenigtkdttgigpsc
pqmylstgngellfqlvgnliniplfqtatlssedcltlniqrpagttsnsslpvlfwif
gggfelgtnqyydgidlltegislgepfifvainyrvggfgflggkeikadgssnlglld
qrialewvadniasfggdpskvtiwgesagsisvfdqmalyggnnkykgkalfrggimns
gsvvpaapvdgvkaqaiydhvvseagcagtsdtlaclrtvdytkfltavnsvpgivsyss
ialsylprpdgvvlidspeeivknkqyaavpmiigdqedegtlfavlpnnitstakivqy
fqdlyfynatkeqltafvntyptditagspfntgifnelypgfkrlaailgdmtftlarr
aflqlcsevnpdvpswsylasydygfpflgtfhatdilqvfygvlpnyasgsiqkyyinf
vttgdpnkgaavdiqwpqwsakknilqiyatkavivadnfraksyeylynnwgifri

SCOPe Domain Coordinates for d4upda1:

Click to download the PDB-style file with coordinates for d4upda1.
(The format of our PDB-style files is described here.)

Timeline for d4upda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4upda2
View in 3D
Domains from other chains:
(mouse over for more information)
d4updb_